MGC51025 Antibody - C-terminal region : HRP

MGC51025 Antibody - C-terminal region : HRP
SKU
AVIARP55784_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MGC51025 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MGC51025

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: LLCLPEEDAFWALTQLLAGERHSLWYSTAQILPGSRGSYRTRSRCCTSPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 26

Protein Size: 250

Purification: Affinity Purified
More Information
SKU AVIARP55784_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55784_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 353149
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×