MGC70924 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC70924

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich protein 19

Protein Size: 356

Purification: Affinity Purified

• SKU: AVIARP55933_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55933_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 284338
• Host: Rabbit