MIF Antibody - middle region : Biotin

MIF Antibody - middle region : Biotin
SKU
AVIARP56347_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIF

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Macrophage migration inhibitory factor

Protein Size: 115

Purification: Affinity Purified
More Information
SKU AVIARP56347_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56347_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 4282
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×