MINDY4B Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC646951

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: inactive ubiquitin carboxyl-terminal hydrolase MINDY-4B

Protein Size: 460

Purification: Affinity Purified

• SKU: AVIARP58494_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58494_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 646951
• Host: Rabbit
• Conjugate: Conjugated, Biotin