MKLN1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MKLN1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Muskelin

Protein Size: 528

Purification: Affinity Purified

• SKU: AVIARP56737_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56737_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4289
• Host: Rabbit