MMD2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMD2

Key Reference: Tang,Y.T., (2005) J. Mol. Evol. 61 (3), 372-380

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Monocyte to macrophage differentiation factor 2

Protein Size: 270

Purification: Affinity Purified

• SKU: AVIARP54545_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54545_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221938
• Host: Rabbit