MOAP1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene was identified by its interaction with apoptosis regulator BAX protein. This protein contains a Bcl-2 homology 3 (BH3)-like motif, which is required for the association with BAX. When overexpressed, this gene has been shown to mediate caspase-dependent apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MOAP1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 351

Purification: Affinity Purified

• SKU: AVIARP57614_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57614_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64112
• Host: Rabbit