MOS Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MOS

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proto-oncogene serine/threonine-protein kinase mos

Protein Size: 346

Purification: Affinity Purified

• SKU: AVIARP56631_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56631_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4342
• Host: Rabbit