Mouse anti Integrin alpha 3B + alpha 6B

Mouse anti Integrin alpha 3B + alpha 6B, IgG1, Clone: PB36
SKU
NORMUB0903P
Packaging Unit
0,1 mg
Manufacturer
Nordic-MUbio

Availability: loading...
Price is loading...
Clone: PB36

Background: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.

Source: PB36 is a Mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.

Specificity: PB36 recognizes the cytoplasmic domain of integrin subunits α3B and α6B. PB36 reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart.

Formulation: Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.

References: 1. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.

UniProt: P26006 and P23229

Caution: This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals. This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water.This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.
More Information
SKU NORMUB0903P
Manufacturer Nordic-MUbio
Manufacturer SKU MUB0903P
Package Unit 0,1 mg
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application Immunohistochemistry (frozen), Western Blotting, Immunocytochemistry
Isotype IgG1
Human Gene ID PB36
Host Mouse
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download