Mouse Interferon-gamma Recombinant

Mouse Interferon-gamma Recombinant
SKU
BPS90163-B
Packaging Unit
100 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAK kDaFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Background: IFN-gamma is produced mainly by T-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFN gamma receptors are expressed on all types of human cells with the exception of mature erythrocytes. IFN-gamma-receptor complexes are rapidly internalized by endocytosis. IFN-gamma has antiviral and antiparasitic activities and also inhibits the proliferation of a number of normal and transformed cells. Interferon-gamma synergises with TNF-alpha and TNF-beta in inhibiting the proliferation of various cell types. The growth inhibitory activities of IFN-gamma are more pronounced than those of the other interferons. However, the main biological activity of IFN-gamma appears to be immunomodulatory in contrast to the other interferons that are mainly antiviral. In T-helper cells, IL-2 induces the synthesis of IFN-gamma and other cytokines. IFN- gamma acts synergistically with IL-1 and IL-2 and appears to be required for the expression of IL-2 receptors on the cell surface of T-lymphocytes. Blocking of the IL-2 receptor by specific antibodies also inhibits the synthesis of IFN-gamma.

Biological Activity: The ED50 was determined by the cytopathic inhibition assay with murine L929 cells challenged with EMC virus to be 0.1 ng/ml

Description: Recombinant Interferon gamma is a disulfide-linked homodimeric protein consisting of 134 amino acid residues, and migrates as an approximately 16 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding murine Interferon-gamma mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered PBS, pH 7.0.

Genbank: P01580

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01580

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Sikorski K, et al. Cytokine Growth Factor Rev. 2011 Aug,22(4):211-9.
2. Gysemans C, et al. Biochem Soc Trans. 2008 Jun,36(Pt 3):328-33.
3. Rameshwar P. Cell Res. 2008 Aug,18(8):805-6.
More Information
SKU BPS90163-B
Manufacturer BPS Bioscience
Manufacturer SKU 90163-B
Green Labware No
Package Unit 100 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×