Mouse Interleukin-11 Recombinant

Mouse Interleukin-11 Recombinant
SKU
BPS90177-A
Packaging Unit
2 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 22-199

Amino Acid Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Background: IL-11 is secreted by bone marrow stromal cells (fibroblasts)and is produced also by a number of mesenchymal cells. The IL-11 receptor (alpha chain) utilizes gp130 as its signal transducer, which is also a component of other cytokine receptors. The alpha chain of the IL-11 receptor has been identified independently as Etl2. IL-11 promotes primary and secondary immune responses in vitro and in vivo and modulates antigen-specific antibody reactions. IL-11 promotes the proliferation of IL-6 dependent plasmacytoma cell lines in the presence of neutralizing IL-6 antibodies. IL-11 also stimulates the T-cell dependent development of IgG-secreting B-cells in spleen cell cultures. IL-11 inhibits the differentiation of pre- adipocytes. It induces the synthesis of some acute phase proteins by hepatocytes.

Biological Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine T11 cells is ≤1.0 ng/ml, corresponding to a specific activity of≥1 x 10^6units/mg.

Description: Recombinant IL-11 is a disulfide-linked monomer protein consisting of 179 amino acid residues, and migrates as an approximately 19 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding mouse Interleukin-11 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered PBS, pH 7.

Genbank: P47873

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P47873

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Immunol., Oct 2009, 183: 4229 - 4240.
2. Am. J. Respir. Cell Mol. Biol., Dec 2008, 39: 739 - 746.
3. Invest. Ophthalmol. Vis. Sci., May 2007, 48: 2524.
More Information
SKU BPS90177-A
Manufacturer BPS Bioscience
Manufacturer SKU 90177-A
Package Unit 2 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×