Mouse Interleukin-3 Recombinant

Mouse Interleukin-3 Recombinant
SKU
BPS90189-B
Packaging Unit
10 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Background: IL-3 is produced mainly by T- cells following cell activation by antigens and mitogens, but also by keratinocytes, NK-cells, mast cells, endothelial cells, and monocytes. The analysis of bacterial- derived recombinant IL-3 shows that glycosylation is not required for the activity of IL-3. IL-3 sequences are evolutionarily not well conserved. Human and murine IL-3 show approximately 29% homology at the protein level while murine and rat IL-3 show approximately 54% homology. IL-3-alpha and IL-3- beta are two isoforms of rat IL-3. IL-3 receptors are expressed on macrophages, mast cells, eosinophils, megakaryocytes, basophils, bone marrow progenitor cells, and various myeloid leukemia cells. IL-3/IL-3 receptor complexes have a Kds of 10-9 - 10-10 M. Binding of IL-3 to its receptor causes specific phosphorylation of a 150 kDa membrane glycoprotein.

Biological Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of mouse M-NFS-60 cells to be <0.05 ng/ml.

Description: Recombinant mouse IL-3 is a disulfide-linked monomer consisting of 135 amino acid residues, and migrates as an approximately 15 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding murine Interleukin-3 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.0.

Genbank: P01586

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01586

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Mol. Cell. Biol., Apr 2009, 29: 1682 - 1693.
2. J. Biol. Chem., Aug 2008, 283: 23505 - 23509.
3. J. Biol. Chem., Jan 2009, 284: 2187 - 2193.
More Information
SKU BPS90189-B
Manufacturer BPS Bioscience
Manufacturer SKU 90189-B
Green Labware No
Package Unit 10 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×