Mpc1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mpc1 may be involved in apoptosis of neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Mpc1

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial pyruvate carrier 1

Protein Size: 109

Purification: Affinity Purified

• SKU: AVIARP56834_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56834_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Yeast
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 171087
• Host: Rabbit