MPP2 Antibody - middle region : Biotin

MPP2 Antibody - middle region : Biotin
SKU
AVIARP56632_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracel

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPP2

Key Reference: Wierstra,I. (2006) Biol. Chem. 387 (7), 963-976

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAGUK p55 subfamily member 2

Protein Size: 552

Purification: Affinity Purified
More Information
SKU AVIARP56632_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56632_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4355
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×