Mprip Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Mouse homolog binds F-actin and may play a role in F-actin bundling and cytoskeleton organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mprip

Molecular Weight: 113kDa

Peptide Sequence: Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin phosphatase Rho-interacting protein

Protein Size: 1029

Purification: Affinity Purified

• SKU: AVIARP57861_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57861_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 116504
• Host: Rabbit