MPV17L Antibody - N-terminal region : HRP

MPV17L Antibody - N-terminal region : HRP
SKU
AVIARP55695_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPV17L

Key Reference: Iida,R., (2006) Biochem. Biophys. Res. Commun. 344 (3), 948-954

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mpv17-like protein

Protein Size: 196

Purification: Affinity Purified
More Information
SKU AVIARP55695_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55695_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 255027
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×