MRE11 Antibody - middle region : HRP

MRE11 Antibody - middle region : HRP
SKU
AVIARP56645_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRE11A

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: RFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: double-strand break repair protein MRE11

Protein Size: 708

Purification: Affinity Purified
More Information
SKU AVIARP56645_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56645_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4361
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×