MRE11 Antibody - N-terminal region : FITC

MRE11 Antibody - N-terminal region : FITC
SKU
AVIARP56644_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRE11A

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: double-strand break repair protein MRE11

Protein Size: 708

Purification: Affinity Purified
More Information
SKU AVIARP56644_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56644_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4361
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×