MRPL47 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPL47

Key Reference: Zhang,Z. (2003) Genomics 81 (5), 468-480

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 39S ribosomal protein L47, mitochondrial

Protein Size: 140

Purification: Affinity Purified

• SKU: AVIARP57768_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57768_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57129
• Host: Rabbit