MS4A4A Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A

Key Reference: Liang,Y., (2001) Immunogenetics 53 (5), 357-368

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Membrane-spanning 4-domains subfamily A member 4A

Protein Size: 239

Purification: Affinity Purified

• SKU: AVIARP58497_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58497_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51338
• Host: Rabbit
• Conjugate: Conjugated, FITC