MSRA Antibody - middle region : Biotin

MSRA Antibody - middle region : Biotin
SKU
AVIARP56732_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MSRA

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial peptide methionine sulfoxide reductase

Protein Size: 235

Purification: Affinity Purified
More Information
SKU AVIARP56732_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56732_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 4482
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×