MTBP Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that interacts with the oncoprotein mouse double minute 2. The encoded protein regulates progression through the cell cycle and may be involved in tumor formation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTBP

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: mdm2-binding protein

Protein Size: 329

Purification: Affinity Purified

• SKU: AVIARP55384_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55384_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27085
• Host: Rabbit