MTBP Antibody - middle region : HRP

MTBP Antibody - middle region : HRP
SKU
AVIARP55384_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that interacts with the oncoprotein mouse double minute 2. The encoded protein regulates progression through the cell cycle and may be involved in tumor formation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTBP

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: mdm2-binding protein

Protein Size: 329

Purification: Affinity Purified
More Information
SKU AVIARP55384_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55384_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27085
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×