MTCH2 Antibody - N-terminal region : FITC

MTCH2 Antibody - N-terminal region : FITC
SKU
AVIARP55028_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTCH2

Key Reference: Grinberg,M., (2005) Mol. Cell. Biol. 25 (11), 4579-4590

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial carrier homolog 2

Protein Size: 303

Purification: Affinity Purified
More Information
SKU AVIARP55028_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55028_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23788
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×