MTHFD2L Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTHFD2L

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2

Protein Size: 347

Purification: Affinity Purified

• SKU: AVIARP56162_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56162_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 441024
• Host: Rabbit