MTIF3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTIF3

Key Reference: Abahuni,N., (2007) Neurosci. Lett. 414 (2), 126-129

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Translation initiation factor IF-3, mitochondrial

Protein Size: 278

Purification: Affinity Purified

• SKU: AVIARP55563_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55563_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 219402
• Host: Rabbit