MTIF3 Antibody - middle region : FITC

MTIF3 Antibody - middle region : FITC
SKU
AVIARP55563_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTIF3

Key Reference: Abahuni,N., (2007) Neurosci. Lett. 414 (2), 126-129

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Translation initiation factor IF-3, mitochondrial

Protein Size: 278

Purification: Affinity Purified
More Information
SKU AVIARP55563_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55563_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219402
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×