MTRF1L Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTRF1L

Key Reference: Nozaki,Y., (2008) Genes Cells 13 (5), 429-438

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptide chain release factor 1-like, mitochondrial

Protein Size: 271

Purification: Affinity Purified

• SKU: AVIARP56320_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56320_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54516
• Host: Rabbit