Mut Antibody - N-terminal region : Biotin

Mut Antibody - N-terminal region : Biotin
SKU
AVIARP56080_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Mut is involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mut

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methylmalonyl-CoA mutase, mitochondrial

Protein Size: 748

Purification: Affinity Purified
More Information
SKU AVIARP56080_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56080_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 17850
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×