MVP Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.This gene encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MVP

Key Reference: de (2008) Cytometry B Clin Cytom 74 (3), 163-168

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major vault protein

Protein Size: 893

Purification: Affinity Purified

• SKU: AVIARP58642_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58642_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9961
• Host: Rabbit
• Conjugate: Conjugated, Biotin