MYBPH Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH

Key Reference: Welikson,R.E. J. Cell. Sci. 115 (PT 17), 3517-3526 (2002)

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myosin-binding protein H

Protein Size: 477

Purification: Affinity Purified

• SKU: AVIARP56598_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56598_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4608
• Host: Rabbit