MYD88 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYD88

Molecular Weight: 32 kDa

Peptide Sequence: Synthetic peptide located within the following region: NVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: myeloid differentiation primary response protein MyD88

Protein Size: 296

Purification: Affinity purified

• SKU: AVIARP58919_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58919_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4615
• Host: Rabbit
• Conjugate: Conjugated, Biotin