MYD88 Antibody - middle region : FITC

MYD88 Antibody - middle region : FITC
SKU
AVIARP58920_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MYD88

Key Reference: N/A

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: AEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myeloid differentiation primary response protein MyD88

Protein Size: 251

Purification: Affinity purified
More Information
SKU AVIARP58920_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58920_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4615
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×