MYD88 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYD88

Key Reference: Dhiman,N., (2008) Vaccine 26 (14), 1731-1736

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myeloid differentiation primary response protein MyD88

Protein Size: 296

Purification: Affinity Purified

• SKU: AVIARP56352_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56352_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4615
• Host: Rabbit