MYO1C Antibody - N-terminal region : HRP

MYO1C Antibody - N-terminal region : HRP
SKU
AVIARP56292_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates wi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYO1C

Key Reference: Kahle,M., (2007) Histochem. Cell Biol. 127 (2), 139-148

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Unconventional myosin-Ic

Protein Size: 1028

Purification: Affinity Purified

Specificity#: isoform 1, 2 and 3
More Information
SKU AVIARP56292_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56292_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4641
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×