MYO1E Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYO1E

Key Reference: Krendel,M., (2007) FEBS Lett. 581 (4), 644-650

Molecular Weight: 127kDa

Peptide Sequence: Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Unconventional myosin-Ie

Protein Size: 1108

Purification: Affinity Purified

• SKU: AVIARP56601_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56601_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4643
• Host: Rabbit