MYO1E Antibody - middle region : HRP

MYO1E Antibody - middle region : HRP
SKU
AVIARP56601_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYO1E

Key Reference: Krendel,M., (2007) FEBS Lett. 581 (4), 644-650

Molecular Weight: 127kDa

Peptide Sequence: Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Unconventional myosin-Ie

Protein Size: 1108

Purification: Affinity Purified
More Information
SKU AVIARP56601_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56601_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4643
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×