NAP1L2 Antibody - middle region : Biotin

NAP1L2 Antibody - middle region : Biotin
SKU
AVIARP57574_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the nucleosome assembly protein (NAP) family. The function of this family member is unknown; however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neuronal cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NAP1L2

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleosome assembly protein 1-like 2

Protein Size: 460

Purification: Affinity Purified
More Information
SKU AVIARP57574_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57574_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4674
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×