Nap1l2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nap1l2 is a acidic protein which may be involved in interactions with other proteins or DNA.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Nap1l2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleosome assembly protein 1-like 2

Protein Size: 460

Purification: Affinity Purified

• SKU: AVIARP57573_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57573_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 17954
• Host: Rabbit