Nap1l5 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GDSAAAPAAEEPQAPAENAPKPKKDFMESLPNSVKCRVLALKKLQKRCDK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleosome assembly protein 1-like 5

Protein Size: 156

Purification: Affinity Purified

• SKU: AVIARP55609_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55609_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 58243
• Host: Rabbit