NARF Antibody - middle region : FITC

NARF Antibody - middle region : FITC
SKU
AVIARP54491_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NARF

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ32404 fis, clone SKMUS2000380, highly similar to Homo sapiens nuclear prelamin A recognition factor (NARF), transcript variant 1, mRNA EMBL BAG51834.1

Protein Size: 397

Purification: Affinity Purified
More Information
SKU AVIARP54491_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54491_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26502
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×