NASP Antibody - middle region : Biotin

NASP Antibody - middle region : Biotin
SKU
AVIARP57746_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localize

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NASP

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear autoantigenic sperm protein (Histone-binding) EMBL CAI22461.1

Protein Size: 449

Purification: Affinity Purified
More Information
SKU AVIARP57746_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57746_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 4678
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×