NDUFA9 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NDUFA9

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

Protein Size: 377

Purification: Affinity Purified

Subunit: 9, mitochondrial

• SKU: AVIARP56604_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56604_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4704
• Host: Rabbit