NDUFS1 Antibody - middle region : HRP

NDUFS1 Antibody - middle region : HRP
SKU
AVIARP56609_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFS1

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Protein Size: 727

Purification: Affinity Purified

Subunit: mitochondrial
More Information
SKU AVIARP56609_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56609_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4719
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×