Ndufs1 Antibody - N-terminal region : Biotin

Ndufs1 Antibody - N-terminal region : Biotin
SKU
AVIARP56608_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ndufs1 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ndufs1

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Protein Size: 727

Purification: Affinity Purified

Subunit: , mitochondrial
More Information
SKU AVIARP56608_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56608_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 301458
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×