NDUFS3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFS3

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

Protein Size: 264

Purification: Affinity Purified

• SKU: AVIARP56578_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56578_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4722
• Host: Rabbit