Ndufv2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Ndufv2

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

Protein Size: 248

Purification: Affinity Purified

• SKU: AVIARP57510_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57510_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 72900
• Host: Rabbit