Necab1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-terminal EF-hand calcium-binding protein 1

Protein Size: 352

Purification: Affinity Purified

• SKU: AVIARP57628_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57628_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 69352
• Host: Rabbit