NEGR1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuronal growth regulator 1

Protein Size: 354

Purification: Affinity Purified

• SKU: AVIARP55701_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55701_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 257194
• Host: Rabbit