NES Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nestin is an intermediate filament protein that was first identified with a monoclonal antibody by Hockfield and McKay (1985) [PubMed 4078630]. It is expressed predominantly in stem cells of the central nervous system in the neural tube. Upon terminal neu

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NES

Key Reference: Scobioala,S., (2008) FASEB J. 22 (4), 1021-1031

Molecular Weight: 177kDa

Peptide Sequence: Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nestin

Protein Size: 1621

Purification: Affinity Purified

• SKU: AVIARP58779_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58779_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 10763
• Host: Rabbit
• Conjugate: Conjugated, HRP